DES monoclonal antibody (M03), clone 1D12
  • DES monoclonal antibody (M03), clone 1D12

DES monoclonal antibody (M03), clone 1D12

Ref: AB-H00001674-M03
DES monoclonal antibody (M03), clone 1D12

Información del producto

Mouse monoclonal antibody raised against a partial recombinant DES.
Información adicional
Size 100 ug
Gene Name DES
Gene Alias CMD1I|CSM1|CSM2|FLJ12025|FLJ39719|FLJ41013|FLJ41793
Gene Description desmin
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq SGYQDNIARLEEEIRHLKDEMARHLREYQDLLNVKMALDVEIATYRKLLEGEESRINLPIQTYSALNFRETSPEQRGSEVHTKKTVMIKTIETRDGEVVSEATQQQHEVL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen DES (NP_001918.3, 361 a.a. ~ 470 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1674
Clone Number 1D12
Iso type IgG2a Kappa

Enviar uma mensagem


DES monoclonal antibody (M03), clone 1D12

DES monoclonal antibody (M03), clone 1D12