View larger
Mouse monoclonal antibody raised against a full-length recombinant DEFA6.
AB-H00001671-M01
New product
DEFA6 monoclonal antibody (M01), clone 2D2
Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.
Data sheet
| Size | 100 ug |
| Gene Name | DEFA6 |
| Gene Alias | DEF6|HD-6 |
| Gene Description | defensin, alpha 6, Paneth cell-specific |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Tr,WB-Re,S-ELISA,ELISA |
| Immunogen Prot. Seq | MRTLTILTAVLLVALQAKAEPLQAEDDPLQAKAYEADAQEQRGANDQDFAVSFAEDASSSLRALGSTRAFTCHCRRSCYSTEYSYGTCTVMGINHRFCCL |
| Antigen species Target species | Human |
| Quality control testing | Antibody Reactive Against Recombinant Protein. |
| Immunogen | DEFA6 (NP_001917.1, 1 a.a. ~ 100 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Storage Buffer | In 1x PBS, pH 7.4 |
| Gene ID | 1671 |
| Clone Number | 2D2 |
| Iso type | IgG2a Kappa |
More info
Mouse monoclonal antibody raised against a full-length recombinant DEFA6.