DEFA1 monoclonal antibody (M03), clone 1B20
  • DEFA1 monoclonal antibody (M03), clone 1B20

DEFA1 monoclonal antibody (M03), clone 1B20

Ref: AB-H00001667-M03
DEFA1 monoclonal antibody (M03), clone 1B20

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant DEFA1.
Información adicional
Size 100 ug
Gene Name DEFA1
Gene Alias DEF1|DEFA2|HNP-1|HP-1|MGC138393|MRS
Gene Description defensin, alpha 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA
Immunogen Prot. Seq MRTLAILAAILLVALQAQAEPLQARADEVAAAPEQIAADIPEVVVSLAWDESLAPKHPGSRKSMDCYCRIPACIAGERRYGTCIYQGRLWAFCC
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen DEFA1 (AAH27917, 1 a.a. ~ 94 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1667
Clone Number 1B20
Iso type IgG2b Kappa

Enviar uma mensagem


DEFA1 monoclonal antibody (M03), clone 1B20

DEFA1 monoclonal antibody (M03), clone 1B20