DDX6 purified MaxPab rabbit polyclonal antibody (D01P)
  • DDX6 purified MaxPab rabbit polyclonal antibody (D01P)

DDX6 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00001656-D01P
DDX6 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human DDX6 protein.
Información adicional
Size 100 ug
Gene Name DDX6
Gene Alias FLJ36338|HLR2|P54|RCK
Gene Description DEAD (Asp-Glu-Ala-Asp) box polypeptide 6
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr,IF
Immunogen Prot. Seq MGLSSQNGQLRGPVKPTGGPGGGGTQTQQQMNQLKNTNTINNGTQQQAQSMTTTIKPGDDWKKTLKLPPKDLRIKTSDVTSTKGNEFEDYCLKRELLMGIFEMGWEKPSPIQEESIPIALSGRDILARAKNGTGKSGAYLIPLLERLDLKKDNIQAMVIVPTRELALQVSQICIQVSKHMGGAKVMATTGGTNLRDDIMRLDDTVHVVIATPGRILDLIKKGVAKVDHVQMIVLDEADKLLSQDFVQIMEDIILT
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen DDX6 (NP_004388.1, 1 a.a. ~ 472 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1656

Enviar uma mensagem


DDX6 purified MaxPab rabbit polyclonal antibody (D01P)

DDX6 purified MaxPab rabbit polyclonal antibody (D01P)