DDX1 monoclonal antibody (M02), clone 4F6
  • DDX1 monoclonal antibody (M02), clone 4F6

DDX1 monoclonal antibody (M02), clone 4F6

Ref: AB-H00001653-M02
DDX1 monoclonal antibody (M02), clone 4F6

Información del producto

Mouse monoclonal antibody raised against a partial recombinant DDX1.
Información adicional
Size 100 ug
Gene Name DDX1
Gene Alias DBP-RB|UKVH5d
Gene Description DEAD (Asp-Glu-Ala-Asp) box polypeptide 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq RLKEDGGCTIWYNEMQLLSEIEEHLNCTISQVEPDIKVPVDEFDGKVTYGQKRAAGGGSYKGHVDILAPTVQELAALEKEAQTSFLHLGYLPNQLFRTF
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen DDX1 (NP_004930, 642 a.a. ~ 740 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1653
Clone Number 4F6
Iso type IgG2b Kappa

Enviar uma mensagem


DDX1 monoclonal antibody (M02), clone 4F6

DDX1 monoclonal antibody (M02), clone 4F6