DDX1 polyclonal antibody (A01)
  • DDX1 polyclonal antibody (A01)

DDX1 polyclonal antibody (A01)

Ref: AB-H00001653-A01
DDX1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant DDX1.
Información adicional
Size 50 uL
Gene Name DDX1
Gene Alias DBP-RB|UKVH5d
Gene Description DEAD (Asp-Glu-Ala-Asp) box polypeptide 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq RLKEDGGCTIWYNEMQLLSEIEEHLNCTISQVEPDIKVPVDEFDGKVTYGQKRAAGGGSYKGHVDILAPTVQELAALEKEAQTSFLHLGYLPNQLFRTF
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen DDX1 (NP_004930, 642 a.a. ~ 740 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 1653

Enviar uma mensagem


DDX1 polyclonal antibody (A01)

DDX1 polyclonal antibody (A01)