DDT purified MaxPab rabbit polyclonal antibody (D01P)
  • DDT purified MaxPab rabbit polyclonal antibody (D01P)

DDT purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00001652-D01P
DDT purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human DDT protein.
Información adicional
Size 100 ug
Gene Name DDT
Gene Alias DDCT
Gene Description D-dopachrome tautomerase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MPFLELDTNLPANRVPAGLEKRLCAAAASILGKPADRVNVTVRPGLAMALSGSTEPCAQLSISSIGVVGTAEDNRSHSAHFFEFLTKELALGQDRILIRFFPLESWQIGKIGTVMTFL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen DDT (NP_001346.1, 1 a.a. ~ 118 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1652

Enviar uma mensagem


DDT purified MaxPab rabbit polyclonal antibody (D01P)

DDT purified MaxPab rabbit polyclonal antibody (D01P)