DDOST polyclonal antibody (A01)
  • DDOST polyclonal antibody (A01)

DDOST polyclonal antibody (A01)

Ref: AB-H00001650-A01
DDOST polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant DDOST.
Información adicional
Size 50 uL
Gene Name DDOST
Gene Alias AGE-R1|KIAA0115|MGC2191|OK/SW-cl.45|OST|OST48|WBP1
Gene Description dolichyl-diphosphooligosaccharide-protein glycosyltransferase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq TDLVEYSIVIQQLSNGKWVPFDGDDIQLEFVRIDPFVRTFLKKKGGKYSVQFKLPDVYGVFQFKVDYNRLGYTHLYSSTQVSVRPLQHTQYERFIPSAYP
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen DDOST (NP_005207, 328 a.a. ~ 427 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 1650

Enviar uma mensagem


DDOST polyclonal antibody (A01)

DDOST polyclonal antibody (A01)