DDIT3 polyclonal antibody (A01)
  • DDIT3 polyclonal antibody (A01)

DDIT3 polyclonal antibody (A01)

Ref: AB-H00001649-A01
DDIT3 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant DDIT3.
Información adicional
Size 50 uL
Gene Name DDIT3
Gene Alias CEBPZ|CHOP|CHOP10|GADD153|MGC4154
Gene Description DNA-damage-inducible transcript 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MAAESLPFSFGTLSSWELEAWYEDLQEVLSSDENGGTYVSPPGNEEEESKIFTTLDPASLAWLTEEEPEPAEVTSTSQSPHSPDSSQSSL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen DDIT3 (AAH03637, 1 a.a. ~ 90 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 1649

Enviar uma mensagem


DDIT3 polyclonal antibody (A01)

DDIT3 polyclonal antibody (A01)