AKR1C2 purified MaxPab rabbit polyclonal antibody (D01P)
  • AKR1C2 purified MaxPab rabbit polyclonal antibody (D01P)

AKR1C2 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00001646-D01P
AKR1C2 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human AKR1C2 protein.
Información adicional
Size 100 ug
Gene Name AKR1C2
Gene Alias AKR1C-pseudo|BABP|DD|DD2|DDH2|HAKRD|HBAB|MCDR2
Gene Description aldo-keto reductase family 1, member C2 (dihydrodiol dehydrogenase 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Ce,WB-Tr
Immunogen Prot. Seq MDSKYQCVKLNDGHFMPVLGFGTYAPAEVPKSKALEAVKLAIEAGFHHIDSAHVYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSNSHRPELVRPALERSLKNLQLDYVDLYLIHFPVSVKPGEEVIPKDENGKILFDTVDLCATWEAMEKCKDAGLAKSIGVSNFNHRLLEMILNKPGLKYKPVCNQVECHPYFNQRKLLDFCKSKDIVLVAYSALGSHREEPWVDPNSPVLLEDPVLCALAKKHKRTPALI
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen AKR1C2 (AAH07024.1, 1 a.a. ~ 323 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1646

Enviar uma mensagem


AKR1C2 purified MaxPab rabbit polyclonal antibody (D01P)

AKR1C2 purified MaxPab rabbit polyclonal antibody (D01P)