AKR1C1 purified MaxPab rabbit polyclonal antibody (D01P)
  • AKR1C1 purified MaxPab rabbit polyclonal antibody (D01P)

AKR1C1 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00001645-D01P
AKR1C1 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human AKR1C1 protein.
Información adicional
Size 100 ug
Gene Name AKR1C1
Gene Alias 2-ALPHA-HSD|20-ALPHA-HSD|C9|DD1|DDH|DDH1|H-37|HAKRC|MBAB|MGC8954
Gene Description aldo-keto reductase family 1, member C1 (dihydrodiol dehydrogenase 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MDSKYQCVKLNDGHFMPVLGFGTYAPAEVPKSKALEATKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWCNSHRPELVRPALERSLKNLQLDYVDLYLIHFPVSVKPGEEVIPKDENGKILFDTVDLCATWEAVEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNQRKLLDFCKSKDIVLVAYSALGSHREEPWVDPNSPVLLEDPVLCALAKKHKRTPALI
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen AKR1C1 (NP_001344.2, 1 a.a. ~ 323 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1645

Enviar uma mensagem


AKR1C1 purified MaxPab rabbit polyclonal antibody (D01P)

AKR1C1 purified MaxPab rabbit polyclonal antibody (D01P)