DCTD MaxPab mouse polyclonal antibody (B01P)
  • DCTD MaxPab mouse polyclonal antibody (B01P)

DCTD MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00001635-B01P
DCTD MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human DCTD protein.
Información adicional
Size 50 ug
Gene Name DCTD
Gene Alias MGC111062
Gene Description dCMP deaminase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MVGGGQPCGPNMSEVSCKKRDDYLEWPEYFMAVAFLSAQRSKDPNSQVGACIVNSENKIVGIGYNGMPNGCSDDVLPWRRTAENKLDTKYPYVCHAELNAIMNKNSTDVKGCSMYVALFPCNECAKLIIQAGIKEVIFMSDKYHDSDEATAARLLFNMAGVTFRKFIPKCSKIVIDFDSINSRPSQKLQ
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen DCTD (NP_001012750.1, 1 a.a. ~ 189 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1635

Enviar uma mensagem


DCTD MaxPab mouse polyclonal antibody (B01P)

DCTD MaxPab mouse polyclonal antibody (B01P)