DCI polyclonal antibody (A01)
  • DCI polyclonal antibody (A01)

DCI polyclonal antibody (A01)

Ref: AB-H00001632-A01
DCI polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant DCI.
Información adicional
Size 50 uL
Gene Name DCI
Gene Alias -
Gene Description dodecenoyl-Coenzyme A delta isomerase (3,2 trans-enoyl-Coenzyme A isomerase)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq RALQLGLLFPPAEALQVGIVDQVVPEEQVQSTALSAIAQWMAIPDHARQLTKAMMRKATASRLVTQRDADVQNFVSFISKDSIQKSLQMYLERLKEEKG
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen DCI (NP_001910, 204 a.a. ~ 302 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 1632

Enviar uma mensagem


DCI polyclonal antibody (A01)

DCI polyclonal antibody (A01)