DBT purified MaxPab rabbit polyclonal antibody (D01P)
  • DBT purified MaxPab rabbit polyclonal antibody (D01P)

DBT purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00001629-D01P
DBT purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human DBT protein.
Información adicional
Size 100 ug
Gene Name DBT
Gene Alias BCATE2|E2|E2B|MGC9061
Gene Description dihydrolipoamide branched chain transacylase E2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Ce,WB-Tr
Immunogen Prot. Seq MAAVRMLRTWSRNAGKLICVRYFQTCGNVHVLKPNYVCFFGYPSFKYSHPHHFLKTTAALRGQVVQFKLSDIGEGIREVTVKEWYVKEGDTVSQFDSICEVQSDKASVTITSRYDGVIKKLYYNLDDIAYVGKPLVDIETEALKDSEEDVVETPAVSHDEHTHQEIKGRKTLATPAVRRLAMENNIKLSEVVGSGKDGRILKEDILNYLEKQTGAILPPSPKVEIMPPPPKPKDMTVPILVSKPPVFTGKDKTEP
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen DBT (AAH16675.1, 1 a.a. ~ 482 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1629

Enviar uma mensagem


DBT purified MaxPab rabbit polyclonal antibody (D01P)

DBT purified MaxPab rabbit polyclonal antibody (D01P)