DBI purified MaxPab rabbit polyclonal antibody (D01P)
  • DBI purified MaxPab rabbit polyclonal antibody (D01P)

DBI purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00001622-D01P
DBI purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human DBI protein.
Información adicional
Size 100 ug
Gene Name DBI
Gene Alias ACBD1|ACBP|CCK-RP|EP|MGC70414
Gene Description diazepam binding inhibitor (GABA receptor modulator, acyl-Coenzyme A binding protein)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MWGDLWLLPPASANPGTGTEAEFEKAAEEVRHLKTKPSDEEMLFIYGHYKQATVGDINTERPGMLDFTGKAKWDAWNELKGTSKEDAMKAYINKVEELKKKYGI
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen DBI (NP_065438.1, 1 a.a. ~ 104 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1622

Enviar uma mensagem


DBI purified MaxPab rabbit polyclonal antibody (D01P)

DBI purified MaxPab rabbit polyclonal antibody (D01P)