DBC1 polyclonal antibody (A01)
  • DBC1 polyclonal antibody (A01)

DBC1 polyclonal antibody (A01)

Ref: AB-H00001620-A01
DBC1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant DBC1.
Información adicional
Size 50 uL
Gene Name DBC1
Gene Alias DBCCR1|FAM5A
Gene Description deleted in bladder cancer 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq LRFNADLLRSAVQQVNQSYTQGGQFYSSSSVMLLLLDIRDRINRLAPPVAPGKPQLDLFSCMLKHRLKLTNSEIIRVNHALDLYNTEILKQSDQMTAKLC
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen DBC1 (NP_055433, 662 a.a. ~ 761 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 1620

Enviar uma mensagem


DBC1 polyclonal antibody (A01)

DBC1 polyclonal antibody (A01)