DAXX purified MaxPab rabbit polyclonal antibody (D01P)
  • DAXX purified MaxPab rabbit polyclonal antibody (D01P)

DAXX purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00001616-D01P
DAXX purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human DAXX protein.
Información adicional
Size 100 ug
Gene Name DAXX
Gene Alias BING2|DAP6|EAP1|MGC126245|MGC126246
Gene Description death-domain associated protein
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IF
Immunogen Prot. Seq MATANSIIVLDDDDEDEAAAQPGPSHPLPNAASPGAEAPSSSEPHGARGSSSSGGKKCYKLENEKLFEEFLELCKMQTADHPEVVPFLYNRQQRAHSLFLASAEFCNILSRVLSRARSRPAKLYVYINELCTVLKAHSAKKKLNLAPAATTSNEPSGNNPPTHLSLDPTNAENTASQSPRTRGSRRQIQRLEQLLALYVAEIRRLQEKELDLSELDDPDSAYLQEARLKRKLIRLFGRLCELKDCSSLTGRVIEQ
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen DAXX (NP_001341.1, 1 a.a. ~ 740 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1616

Enviar uma mensagem


DAXX purified MaxPab rabbit polyclonal antibody (D01P)

DAXX purified MaxPab rabbit polyclonal antibody (D01P)