DARS monoclonal antibody (M01), clone 2F11
  • DARS monoclonal antibody (M01), clone 2F11

DARS monoclonal antibody (M01), clone 2F11

Ref: AB-H00001615-M01
DARS monoclonal antibody (M01), clone 2F11

Información del producto

Mouse monoclonal antibody raised against a partial recombinant DARS.
Información adicional
Size 100 ug
Gene Name DARS
Gene Alias DKFZp781B11202|MGC111579
Gene Description aspartyl-tRNA synthetase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr,WB-Re,IHC-P,S-ELISA,ELISA,RNAi-Ab
Immunogen Prot. Seq KYPLAVRPFYTMPDPRNPKQSNSYDMFMRGEEILSGAQRIHDPQLLTERALHHGIDLEKIKAYIDSFRFGAPPHAGGGIGLERVTMLFLGLHNVRQTSMFPRDPKRLT
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen DARS (NP_001340, 393 a.a. ~ 500 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1615
Clone Number 2F11
Iso type IgG2a Kappa

Enviar uma mensagem


DARS monoclonal antibody (M01), clone 2F11

DARS monoclonal antibody (M01), clone 2F11