DARS purified MaxPab mouse polyclonal antibody (B01P)
  • DARS purified MaxPab mouse polyclonal antibody (B01P)

DARS purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00001615-B01P
DARS purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human DARS protein.
Información adicional
Size 50 ug
Gene Name DARS
Gene Alias DKFZp781B11202|MGC111579
Gene Description aspartyl-tRNA synthetase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IF
Immunogen Prot. Seq MPSASASRKSQEKPREIMDAAEDYAKERYGISSMIQSQEKPDRVLVRVRDLTIQKADEVVWVRARVHTSRAKGKQCFLVLRQQQFNVQALVAVGDHASKQMVKFAANINKESIVDVEGVVRKVNQKIGSCTQQDVELHVQKIYVISLAEPRLPLQLDDAVRPEAEGEEEGRATVNQDTRLDNRVIDLRTSTSQAVFRLQSGICHLFRETLINKGFVEIQTPKIISAASEGGANVFTVSYFKNNAYLAQSPQLYKQ
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen DARS (NP_001340.2, 1 a.a. ~ 501 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1615

Enviar uma mensagem


DARS purified MaxPab mouse polyclonal antibody (B01P)

DARS purified MaxPab mouse polyclonal antibody (B01P)