DAPK3 polyclonal antibody (A01)
  • DAPK3 polyclonal antibody (A01)

DAPK3 polyclonal antibody (A01)

Ref: AB-H00001613-A01
DAPK3 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant DAPK3.
Información adicional
Size 50 uL
Gene Name DAPK3
Gene Alias FLJ36473|ZIP|ZIPK
Gene Description death-associated protein kinase 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq ALAAIYEEKEAWYREESDSLGQDLRRLRQELLKTEALKRQAQEEAKGALLGTSGLKRRFSRLENRYEALAKQVASEMRFVQDLVRALEQEKLQGVECGLR
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen DAPK3 (NP_001339, 355 a.a. ~ 454 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 1613

Enviar uma mensagem


DAPK3 polyclonal antibody (A01)

DAPK3 polyclonal antibody (A01)