View larger
Rabbit polyclonal antibody raised against a full-length human DGKA protein.
AB-H00001606-D01
New product
DGKA MaxPab rabbit polyclonal antibody (D01)
Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.
Data sheet
| Size | 100 uL |
| Gene Name | DGKA |
| Gene Alias | DAGK|DAGK1|DGK-alpha|MGC12821|MGC42356 |
| Gene Description | diacylglycerol kinase, alpha 80kDa |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Ti,WB-Ce,WB-Tr,IP |
| Immunogen Prot. Seq | MAKERGLISPSDFAQLQKYMEYSTKKVSDVLKLFEDGEMAKYVQGDAIGYEGFQQFLKIYLEVDNVPRHLSLALFQSFETGHCLNETNVTKDVVCLNDVSCYFSLLEGGRPEDKLEFTFKLYDTDRNGILDSSEVDKIILQMMRVAEYLDWDVSELRPILQEMMKEIDYDGSGSVSQAEWVRAGATTVPLLVLLGLEMTLKDDGQHMWRPKRFPRPVYCNLCESSIGLGKQGLSCNLCKYTVHDQCAMKALPCEV |
| Antigen species Target species | Human |
| Quality control testing | Antibody reactive against mammalian transfected lysate. |
| Immunogen | DGKA (NP_001336.2, 1 a.a. ~ 735 a.a) full-length human protein. |
| Storage Buffer | No additive |
| Gene ID | 1606 |
More info
Rabbit polyclonal antibody raised against a full-length human DGKA protein.