DAD1 monoclonal antibody (M03A), clone S1
  • DAD1 monoclonal antibody (M03A), clone S1

DAD1 monoclonal antibody (M03A), clone S1

Ref: AB-H00001603-M03A
DAD1 monoclonal antibody (M03A), clone S1

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant DAD1.
Información adicional
Size 200 uL
Gene Name DAD1
Gene Alias OST2
Gene Description defender against cell death 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA
Immunogen Prot. Seq MSASVVSVISRFLEEYLSSTPQRLKLLDAYLLYILLTGALQFGYCLLVGTFPFNSFLSGFISCVGSFILAVCLRIQINPQNKADFQGISPERAFADFLFASTILHLVVMNFVG
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen DAD1 (AAH07403, 1 a.a. ~ 113 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In ascites fluid
Gene ID 1603
Clone Number S1
Iso type IgG2b Kappa

Enviar uma mensagem


DAD1 monoclonal antibody (M03A), clone S1

DAD1 monoclonal antibody (M03A), clone S1