DAD1 polyclonal antibody (A01)
  • DAD1 polyclonal antibody (A01)

DAD1 polyclonal antibody (A01)

Ref: AB-H00001603-A01
DAD1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a full-length recombinant DAD1.
Información adicional
Size 50 uL
Gene Name DAD1
Gene Alias OST2
Gene Description defender against cell death 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA
Immunogen Prot. Seq MSASVVSVISRFLEEYLSSTPQRLKLLDAYLLYILLTGALQFGYCLLVGTFPFNSFLSGFISCVGSFILAVCLRIQINPQNKADFQGISPERAFADFLFASTILHLVVMNFVG
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen DAD1 (AAH07403, 1 a.a. ~ 113 a.a) full-length recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 1603

Enviar uma mensagem


DAD1 polyclonal antibody (A01)

DAD1 polyclonal antibody (A01)