CYP51A1 purified MaxPab rabbit polyclonal antibody (D01P)
  • CYP51A1 purified MaxPab rabbit polyclonal antibody (D01P)

CYP51A1 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00001595-D01P
CYP51A1 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human CYP51A1 protein.
Información adicional
Size 100 ug
Gene Name CYP51A1
Gene Alias CP51|CYP51|CYPL1|LDM|P450-14DM|P450L1
Gene Description cytochrome P450, family 51, subfamily A, polypeptide 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MAAAAGMLLLGLLQAGGSVLGQAMEKVTGGNLLSMLLIACAFTLSLVYLIRLAAGHLVQLPAGVKSPPYIFSPIPFLGHAIAFGKSPIEFLENAYEKYGPVFSFTMVGKTFTYLLGSDAAALLFNSKNEDLNAEDVYSRLTTPVFGKGVAYDVPNPVFLEQKKMLKSGLNIAHFKQHVSIIEKETKEYFESWGESGEKNVFEALSELIILTASHCLHGKEIRSQLNEKVAQLYADLDGGFSHAAWLLPGWLPLPS
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CYP51A1 (ABM85421.1, 1 a.a. ~ 509 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1595

Enviar uma mensagem


CYP51A1 purified MaxPab rabbit polyclonal antibody (D01P)

CYP51A1 purified MaxPab rabbit polyclonal antibody (D01P)