CYP27A1 purified MaxPab rabbit polyclonal antibody (D01P)
  • CYP27A1 purified MaxPab rabbit polyclonal antibody (D01P)

CYP27A1 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00001593-D01P
CYP27A1 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human CYP27A1 protein.
Información adicional
Size 100 ug
Gene Name CYP27A1
Gene Alias CP27|CTX|CYP27
Gene Description cytochrome P450, family 27, subfamily A, polypeptide 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MAALGCARLRWALRGAGRGLCPHGARAKAAIPAALPSDKATGAPGAGPGVRRRQRSLEEIPRLGQLRFFFQLFVQGYALQLHQLQVLYKAKYGPMWMSYLGPQMHVNLASAPLLEQVMRQEGKYPVRNDMELWKEHRDQHDLTYGPFTTEGHHWYQLRQALNQRLLKPAEAALYTDAFNEVIDDFMTRLDQLRAESASGNQVSDMAQLFYYFALEAICYILFEKRIGCLQRSIPEDTVTFVRSIGLMFQNSLYAT
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CYP27A1 (NP_000775.1, 1 a.a. ~ 531 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1593

Enviar uma mensagem


CYP27A1 purified MaxPab rabbit polyclonal antibody (D01P)

CYP27A1 purified MaxPab rabbit polyclonal antibody (D01P)