CYP24A1 monoclonal antibody (M07), clone 1F8
  • CYP24A1 monoclonal antibody (M07), clone 1F8

CYP24A1 monoclonal antibody (M07), clone 1F8

Ref: AB-H00001591-M07
CYP24A1 monoclonal antibody (M07), clone 1F8

Información del producto

Mouse monoclonal antibody raised against a partial recombinant CYP24A1.
Información adicional
Size 100 ug
Gene Name CYP24A1
Gene Alias CP24|CYP24|MGC126273|MGC126274|P450-CC24
Gene Description cytochrome P450, family 24, subfamily A, polypeptide 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq LMLNTQVLGSSEDNFEDSSQFRPERWLQEKEKINPFAHLPFGVGKRMCIGRRLAELQLHLALCWIVRKYDIQATDNEPVEMLHSGTLVPSRELPIAFCQR
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CYP24A1 (NP_000773, 415 a.a. ~ 514 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1591
Clone Number 1F8
Iso type IgG2a Kappa

Enviar uma mensagem


CYP24A1 monoclonal antibody (M07), clone 1F8

CYP24A1 monoclonal antibody (M07), clone 1F8