CYP24A1 polyclonal antibody (A01)
  • CYP24A1 polyclonal antibody (A01)

CYP24A1 polyclonal antibody (A01)

Ref: AB-H00001591-A01
CYP24A1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant CYP24A1.
Información adicional
Size 50 uL
Gene Name CYP24A1
Gene Alias CP24|CYP24|MGC126273|MGC126274|P450-CC24
Gene Description cytochrome P450, family 24, subfamily A, polypeptide 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq LMLNTQVLGSSEDNFEDSSQFRPERWLQEKEKINPFAHLPFGVGKRMCIGRRLAELQLHLALCWIVRKYDIQATDNEPVEMLHSGTLVPSRELPIAFCQR
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CYP24A1 (NP_000773, 415 a.a. ~ 514 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 1591

Enviar uma mensagem


CYP24A1 polyclonal antibody (A01)

CYP24A1 polyclonal antibody (A01)