CYP11B1 purified MaxPab rabbit polyclonal antibody (D01P)
  • CYP11B1 purified MaxPab rabbit polyclonal antibody (D01P)

CYP11B1 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00001584-D01P
CYP11B1 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human CYP11B1 protein.
Información adicional
Size 100 ug
Gene Name CYP11B1
Gene Alias CPN1|CYP11B|DKFZp686B05283|FHI|FLJ36771|P450C11
Gene Description cytochrome P450, family 11, subfamily B, polypeptide 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MALRAKAEVCMAVPWLSLQRAQALGTRAARVPRTVLPFEAMPRRPGNRWLRLLQIWREQGYEDLHLEVHQTFQELGPIFRSRHSASFGRWGRSAARAGLWRCQGRGWCRANPSSLQRGQDSEALKYDLGGAGMVCVMLPEDVEKLQQVDSLHPHRMSLEPWVAYRQHRGHKCGVFLLNVADRGNSSPPFPGGIHGAPTHSGCRNGPEWRFNRLRLNPEVLSPNAVQRFLPMVDAVARDFSQALKKKVLQNARGSL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CYP11B1 (AAH96285.1, 1 a.a. ~ 574 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1584

Enviar uma mensagem


CYP11B1 purified MaxPab rabbit polyclonal antibody (D01P)

CYP11B1 purified MaxPab rabbit polyclonal antibody (D01P)