CYP4A11 purified MaxPab mouse polyclonal antibody (B01P)
  • CYP4A11 purified MaxPab mouse polyclonal antibody (B01P)

CYP4A11 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00001579-B01P
CYP4A11 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human CYP4A11 protein.
Información adicional
Size 50 ug
Gene Name CYP4A11
Gene Alias CP4Y|CYP4A2|CYP4AII
Gene Description cytochrome P450, family 4, subfamily A, polypeptide 11
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MSVSVLSPSRLLGDVSGILQAASLLILLLLLIKAVQLYLHRQWLLKALQQSPCPPSHWLFGHIQELQQDQELQRIQKWVETFPSACPHWLWGGKVRVQLYDPDYMKVILGRSDPKSHGSYRFLAPWIGYGLLLLNGQTWFQHRRMLTPAFHYDILKPYVGLMADSVRVMLDKWEELLGQDSPLEVFQHVSLMTLDTIMKCAFRHWQRAQHSRHLP
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CYP4A11 (AAH22851, 1 a.a. ~ 215 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1579

Enviar uma mensagem


CYP4A11 purified MaxPab mouse polyclonal antibody (B01P)

CYP4A11 purified MaxPab mouse polyclonal antibody (B01P)