CYP2J2 monoclonal antibody (M01), clone 2D10
  • CYP2J2 monoclonal antibody (M01), clone 2D10

CYP2J2 monoclonal antibody (M01), clone 2D10

Ref: AB-H00001573-M01
CYP2J2 monoclonal antibody (M01), clone 2D10

Información del producto

Mouse monoclonal antibody raised against a partial recombinant CYP2J2.
Información adicional
Size 100 ug
Gene Name CYP2J2
Gene Alias CPJ2
Gene Description cytochrome P450, family 2, subfamily J, polypeptide 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq LHRDPTEWATPDTFNPDHFLENGQFKKREAFMPFSIGKRACLGEQLARTELFIFFTSLMQKFTFRPPNNEKLSLKFRMGITISPVSHRLCA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CYP2J2 (NP_000766, 408 a.a. ~ 498 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1573
Clone Number 2D10
Iso type IgG1 Kappa

Enviar uma mensagem


CYP2J2 monoclonal antibody (M01), clone 2D10

CYP2J2 monoclonal antibody (M01), clone 2D10