CYP2J2 polyclonal antibody (A01)
  • CYP2J2 polyclonal antibody (A01)

CYP2J2 polyclonal antibody (A01)

Ref: AB-H00001573-A01
CYP2J2 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant CYP2J2.
Información adicional
Size 50 uL
Gene Name CYP2J2
Gene Alias CPJ2
Gene Description cytochrome P450, family 2, subfamily J, polypeptide 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq LHRDPTEWATPDTFNPDHFLENGQFKKREAFMPFSIGKRACLGEQLARTELFIFFTSLMQKFTFRPPNNEKLSLKFRMGITISPVSHRLCA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CYP2J2 (NP_000766, 408 a.a. ~ 498 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 1573

Enviar uma mensagem


CYP2J2 polyclonal antibody (A01)

CYP2J2 polyclonal antibody (A01)