CYP2F1 polyclonal antibody (A01)
  • CYP2F1 polyclonal antibody (A01)

CYP2F1 polyclonal antibody (A01)

Ref: AB-H00001572-A01
CYP2F1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant CYP2F1.
Información adicional
Size 50 uL
Gene Name CYP2F1
Gene Alias C2F1|CYP2F|MGC126121
Gene Description cytochrome P450, family 2, subfamily F, polypeptide 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq DDERLLTIIRLINDNFQIMSSPWGELYDIFPSLLDWVPGPHQRIFQNFKCLRDLIAHSVHDHQASLDPRSPRDFIQCFLTKMAEEKEDPLSHFHMDTLLM
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CYP2F1 (NP_000765, 191 a.a. ~ 290 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 1572

Enviar uma mensagem


CYP2F1 polyclonal antibody (A01)

CYP2F1 polyclonal antibody (A01)