CYP2E1 purified MaxPab rabbit polyclonal antibody (D01P)
  • CYP2E1 purified MaxPab rabbit polyclonal antibody (D01P)

CYP2E1 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00001571-D01P
CYP2E1 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human CYP2E1 protein.
Información adicional
Size 100 ug
Gene Name CYP2E1
Gene Alias CPE1|CYP2E|P450-J|P450C2E
Gene Description cytochrome P450, family 2, subfamily E, polypeptide 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MSALGVTVALLVWAAFLLLVSMWRQVHSSWNLPPGPFPLPIIGNLFQLELKNIPKSFTRLAQRFGPVFTLYVGSQRMVVMHGYKAVKEALLDYKDEFSGRGDLPAFHAHRDRGIIFNNGPTWKDIRRFSLTTLRNYGMGKQGNESRIQREAHFLLEALRKTQGQPFDPTFLIGCAPCNVIADILFRKHFDYNDEKFLRLMYLFNENFHLLSTPWLQLYNNFPSFLHYLPGSHRKVIKNVAEVKEYVSERVKEHHQ
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CYP2E1 (NP_000764.1, 1 a.a. ~ 493 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1571

Enviar uma mensagem


CYP2E1 purified MaxPab rabbit polyclonal antibody (D01P)

CYP2E1 purified MaxPab rabbit polyclonal antibody (D01P)