CYP2D6 purified MaxPab rabbit polyclonal antibody (D01P)
  • CYP2D6 purified MaxPab rabbit polyclonal antibody (D01P)

CYP2D6 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00001565-D01P
CYP2D6 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human CYP2D6 protein.
Información adicional
Size 100 ug
Gene Name CYP2D6
Gene Alias CPD6|CYP2D|CYP2D@|CYP2DL1|MGC120389|MGC120390|P450-DB1|P450C2D|P450DB1
Gene Description cytochrome P450, family 2, subfamily D, polypeptide 6
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MGLEALVPLAVIVAIFLLLVDLMHRRQRWAARYPPGPLPLPGLGNLLHVDFQNTPYCFDQLRRRFGDVFSLQLAWTPVVVLNGLAAVREALVTHGEDTADRPPVPITQILGFGPRSQGVFLARYGPAWREQRRFSVSTLRNLGLGKKSLEQWVTEEAACLCAAFANHSGRPFRPNGLLDKAVSNVIASLTCGRRFEYDDPRFLRLLDLAQEGLKEESGFLREVLNAVPVLLHIPALAGKVLRFQKAFLTQLDELL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CYP2D6 (AAH75023.1, 1 a.a. ~ 497 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1565

Enviar uma mensagem


CYP2D6 purified MaxPab rabbit polyclonal antibody (D01P)

CYP2D6 purified MaxPab rabbit polyclonal antibody (D01P)