CYP2C18 polyclonal antibody (A01)
  • CYP2C18 polyclonal antibody (A01)

CYP2C18 polyclonal antibody (A01)

Ref: AB-H00001562-A01
CYP2C18 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant CYP2C18.
Información adicional
Size 50 uL
Gene Name CYP2C18
Gene Alias CPCI|CYP2C|CYP2C17|DKFZp686I24235|P450-6B/29C|P450IIC17
Gene Description cytochrome P450, family 2, subfamily C, polypeptide 18
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq KFNENLRILSSPWIQVCNNFPALIDYLPGSHNKIAENFAYIKSYVLERIKEHQESLDMNSARDFIDCFLIKMEQEKHNQQSEFTVESLIATVTDMFGAGT
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CYP2C18 (NP_000763, 200 a.a. ~ 299 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 1562

Enviar uma mensagem


CYP2C18 polyclonal antibody (A01)

CYP2C18 polyclonal antibody (A01)