CYP2C8 purified MaxPab rabbit polyclonal antibody (D01P)
  • CYP2C8 purified MaxPab rabbit polyclonal antibody (D01P)

CYP2C8 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00001558-D01P
CYP2C8 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human CYP2C8 protein.
Información adicional
Size 100 ug
Gene Name CYP2C8
Gene Alias CPC8|MP-12/MP-20
Gene Description cytochrome P450, family 2, subfamily C, polypeptide 8
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MEPFVVLVLCLSFMLLFSLWRQSCRRRKLPPGPTPLPIIGNMLQIDVKDICKSFTNFSKVYGPVFTVYFGMNPIVVFHGYESVKEALIDNGEEFSGRGNSPISQRITKGLGIISSNGKRWKEIRRFSLTTLRNFGMGKRSIEDRVQEEAHCLVEELRKTKASPCDPTFILGCAPCNVICSVVFQKRFDYKDQNFLTLMKRFNENFRILNSPWIQVCNNFPLLIDCFPGTHNKVLKNVALTRSYIREKVKEHQASL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CYP2C8 (AAH20596.1, 1 a.a. ~ 490 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1558

Enviar uma mensagem


CYP2C8 purified MaxPab rabbit polyclonal antibody (D01P)

CYP2C8 purified MaxPab rabbit polyclonal antibody (D01P)