CYP2A6 purified MaxPab rabbit polyclonal antibody (D01P)
  • CYP2A6 purified MaxPab rabbit polyclonal antibody (D01P)

CYP2A6 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00001548-D01P
CYP2A6 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human CYP2A6 protein.
Información adicional
Size 100 ug
Gene Name CYP2A6
Gene Alias CPA6|CYP2A|CYP2A3|P450C2A|P450PB
Gene Description cytochrome P450, family 2, subfamily A, polypeptide 6
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MLASGMLLVALLVCLTVMVLMSVWQQRKSKGKLPPGPTPLPFIGNYLQLNTEQMYNSLMKISERYGPVFTIHLGPRRVVVLCGHDAVREALVDQAEEFSGRGEQATFDWVFKGYGVVFSNGERAKQLRRFSIATLRDFGVGKRGIEERIQEEAGFLIDAHRGTGGANIDPTFFLSRTVSNVISSIVFGDRFDYKDKEFLSLLRMMLGIFQFTSTSTGQLYEMFSSVMKHLPGPQQQAFQLLQGLEDFIAKKVEHN
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CYP2A6 (AAH96255.1, 1 a.a. ~ 494 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1548

Enviar uma mensagem


CYP2A6 purified MaxPab rabbit polyclonal antibody (D01P)

CYP2A6 purified MaxPab rabbit polyclonal antibody (D01P)