CYP1A2 monoclonal antibody (M08), clone 2G5
  • CYP1A2 monoclonal antibody (M08), clone 2G5

CYP1A2 monoclonal antibody (M08), clone 2G5

Ref: AB-H00001544-M08
CYP1A2 monoclonal antibody (M08), clone 2G5

Información del producto

Mouse monoclonal antibody raised against a partial recombinant CYP1A2.
Información adicional
Size 100 ug
Gene Name CYP1A2
Gene Alias CP12|P3-450|P450(PA)
Gene Description cytochrome P450, family 1, subfamily A, polypeptide 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq ESSDEMLSLVKNTHEFVETASSGNPLDFFPILRYLPNPALQRFKAFNQRFLWFLQKTVQEHYQDFDKNSVRDITGALFKHSKKGPRASGNLIPQEKIVNL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CYP1A2 (NP_000752, 211 a.a. ~ 310 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1544
Clone Number 2G5
Iso type IgG3 Kappa

Enviar uma mensagem


CYP1A2 monoclonal antibody (M08), clone 2G5

CYP1A2 monoclonal antibody (M08), clone 2G5