CYP1A2 polyclonal antibody (A01)
  • CYP1A2 polyclonal antibody (A01)

CYP1A2 polyclonal antibody (A01)

Ref: AB-H00001544-A01
CYP1A2 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant CYP1A2.
Información adicional
Size 50 uL
Gene Name CYP1A2
Gene Alias CP12|P3-450|P450(PA)
Gene Description cytochrome P450, family 1, subfamily A, polypeptide 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq ESSDEMLSLVKNTHEFVETASSGNPLDFFPILRYLPNPALQRFKAFNQRFLWFLQKTVQEHYQDFDKNSVRDITGALFKHSKKGPRASGNLIPQEKIVNL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CYP1A2 (NP_000752, 211 a.a. ~ 310 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 1544

Enviar uma mensagem


CYP1A2 polyclonal antibody (A01)

CYP1A2 polyclonal antibody (A01)