CTSL1 purified MaxPab rabbit polyclonal antibody (D01P)
  • CTSL1 purified MaxPab rabbit polyclonal antibody (D01P)

CTSL1 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00001514-D01P
CTSL1 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human CTSL1 protein.
Información adicional
Size 100 ug
Gene Name CTSL1
Gene Alias CATL|CTSL|FLJ31037|MEP
Gene Description cathepsin L1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MNPTLILAAFCLGIASATLTFDHSLEAQWTKWKAMHNRLYGMNEEGWRRAVWEKNMKMIELHNQEYREGKHSFTMAMNAFGDMTSEEFRQVMNGFQNRKPRKGKVFQEPLFYEAPRSVDWREKGYVTPVKNQGQCGSCWAFSATGALEGQMFRKTGRLISLSEQNLVDCSGPQGNEGCNGGLMDYAFQYVQDNGGLDSEESYPYEATEESCKYNPKYSVANDTGFVDIPKQEKALMKAVATVGPISVAIDAGHES
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CTSL1 (NP_001903.1, 1 a.a. ~ 333 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1514

Enviar uma mensagem


CTSL1 purified MaxPab rabbit polyclonal antibody (D01P)

CTSL1 purified MaxPab rabbit polyclonal antibody (D01P)