CTSB purified MaxPab mouse polyclonal antibody (B01P)
  • CTSB purified MaxPab mouse polyclonal antibody (B01P)

CTSB purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00001508-B01P
CTSB purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human CTSB protein.
Información adicional
Size 50 ug
Gene Name CTSB
Gene Alias APPS|CPSB
Gene Description cathepsin B
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MWQLWASLCCLLVLANARSRPSFHPLSDELVNYVNKRNTTWQAGHNFYNVDMSYLKRLCGTFLGGPKPPQRVMFTEDLKLPASFDAREQWPQCPTIKEIRDQGSCGSCWAFGAVEAISDRICIHTNAHVSVEVSAEDLLTCCGSMCGDGCNGGYPAEAWNFWTRKGLVSGGLYESHVGCRPYSIPPCEHHVNGSRPPCTGEGDTPKCSKICEPGYSPTYKQDKHYGYNSYSVSNSEKDIMAEIYKNGPVEGAFSV
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CTSB (NP_001899.1, 1 a.a. ~ 339 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1508

Enviar uma mensagem


CTSB purified MaxPab mouse polyclonal antibody (B01P)

CTSB purified MaxPab mouse polyclonal antibody (B01P)