CTRL polyclonal antibody (A01)
  • CTRL polyclonal antibody (A01)

CTRL polyclonal antibody (A01)

Ref: AB-H00001506-A01
CTRL polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant CTRL.
Información adicional
Size 50 uL
Gene Name CTRL
Gene Alias CTRL1|MGC70821
Gene Description chymotrypsin-like
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq HFVVLGEYDRSSNAEPLQVLSVSRAITHPSWNSTTMNNDVTLLKLASPAQYTTRISPVCLASSNEALTEGLTCVTTGWGRLSGVGNVTPAHLQQVALPLVTVNQCRQYW
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CTRL (NP_001898, 83 a.a. ~ 191 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 1506

Enviar uma mensagem


CTRL polyclonal antibody (A01)

CTRL polyclonal antibody (A01)