CTRB1 polyclonal antibody (A01)
  • CTRB1 polyclonal antibody (A01)

CTRB1 polyclonal antibody (A01)

Ref: AB-H00001504-A01
CTRB1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant CTRB1.
Información adicional
Size 50 uL
Gene Name CTRB1
Gene Alias CTRB|FLJ42412|MGC88037
Gene Description chymotrypsinogen B1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq LKIAKVFKNPKFSILTVNNDITLLKLATPARFSQTVSAVCLPSADDDFPAGTLCATTGWGKTKYNANKTPDKLQQAALPLLSNAECKKSWGRRITDVMIC
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CTRB1 (NP_001897, 101 a.a. ~ 200 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 1504

Enviar uma mensagem


CTRB1 polyclonal antibody (A01)

CTRB1 polyclonal antibody (A01)