CTNND2 polyclonal antibody (A01)
  • CTNND2 polyclonal antibody (A01)

CTNND2 polyclonal antibody (A01)

Ref: AB-H00001501-A01
CTNND2 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant CTNND2.
Información adicional
Size 50 uL
Gene Name CTNND2
Gene Alias GT24|NPRAP
Gene Description catenin (cadherin-associated protein), delta 2 (neural plakophilin-related arm-repeat protein)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq ISLKERKTDYECTGSNATYHGAKGEHTSRKDAMTAQNTGISTLYRNSYGAPAEDIKHNQVSAQPVPQEPSRKDYETYQPFQNSTRNYDESFFEDQVHHRPPASEYTMHLG
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CTNND2 (NP_001323, 1081 a.a. ~ 1190 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 1501

Enviar uma mensagem


CTNND2 polyclonal antibody (A01)

CTNND2 polyclonal antibody (A01)