CTNNA1 monoclonal antibody (M03), clone 4G6
  • CTNNA1 monoclonal antibody (M03), clone 4G6

CTNNA1 monoclonal antibody (M03), clone 4G6

Ref: AB-H00001495-M03
CTNNA1 monoclonal antibody (M03), clone 4G6

Información del producto

Mouse monoclonal antibody raised against a partial recombinant CTNNA1.
Información adicional
Size 100 ug
Gene Name CTNNA1
Gene Alias CAP102|FLJ36832
Gene Description catenin (cadherin-associated protein), alpha 1, 102kDa
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA,PLA-Ce
Immunogen Prot. Seq VQLKVVEDGILKLRNAGNEQDLGIQYKALKPEVDKLNIMAAKRQQELKDVGHRDQMAAARGILQKNVPILYTASQACLQHPDVAAYKANRDLIYKQLQQ
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CTNNA1 (NP_001894, 152 a.a. ~ 250 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1495
Clone Number 4G6
Iso type IgG1 Kappa

Enviar uma mensagem


CTNNA1 monoclonal antibody (M03), clone 4G6

CTNNA1 monoclonal antibody (M03), clone 4G6