CTLA4 monoclonal antibody (M08A), clone 1F4
  • CTLA4 monoclonal antibody (M08A), clone 1F4

CTLA4 monoclonal antibody (M08A), clone 1F4

Ref: AB-H00001493-M08A
CTLA4 monoclonal antibody (M08A), clone 1F4

Información del producto

Mouse monoclonal antibody raised against a partial recombinant CTLA4.
Información adicional
Size 200 uL
Gene Name CTLA4
Gene Alias CD152|CELIAC3|CTLA-4|GSE|IDDM12
Gene Description cytotoxic T-lymphocyte-associated protein 4
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq KAMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMY
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CTLA4 (NP_005205, 36 a.a. ~ 135 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In ascites fluid
Gene ID 1493
Clone Number 1F4
Iso type IgG2a Kappa

Enviar uma mensagem


CTLA4 monoclonal antibody (M08A), clone 1F4

CTLA4 monoclonal antibody (M08A), clone 1F4