CTLA4 polyclonal antibody (A01)
  • CTLA4 polyclonal antibody (A01)

CTLA4 polyclonal antibody (A01)

Ref: AB-H00001493-A01
CTLA4 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant CTLA4.
Información adicional
Size 50 uL
Gene Name CTLA4
Gene Alias CD152|CELIAC3|CTLA-4|GSE|IDDM12
Gene Description cytotoxic T-lymphocyte-associated protein 4
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq KAMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMY
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CTLA4 (NP_005205, 36 a.a. ~ 135 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 1493

Enviar uma mensagem


CTLA4 polyclonal antibody (A01)

CTLA4 polyclonal antibody (A01)