CTBS monoclonal antibody (M01), clone 1B5-1B9
  • CTBS monoclonal antibody (M01), clone 1B5-1B9

CTBS monoclonal antibody (M01), clone 1B5-1B9

Ref: AB-H00001486-M01
CTBS monoclonal antibody (M01), clone 1B5-1B9

Información del producto

Mouse monoclonal antibody raised against a full length recombinant CTBS.
Información adicional
Size 100 ug
Gene Name CTBS
Gene Alias CTB
Gene Description chitobiase, di-N-acetyl-
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,S-ELISA,ELISA
Immunogen Prot. Seq DCPCPEPELCRPIRHHPDFEVFVFDVGQKTWKSYDWSQITTVATFGKYDSELMCYAHSKGARVVLKGNL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CTBS (AAH24007.2, 37 a.a. ~ 105 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1486
Clone Number 1B5-1B9
Iso type IgG1 kappa

Enviar uma mensagem


CTBS monoclonal antibody (M01), clone 1B5-1B9

CTBS monoclonal antibody (M01), clone 1B5-1B9