CTBS purified MaxPab rabbit polyclonal antibody (D01P)
  • CTBS purified MaxPab rabbit polyclonal antibody (D01P)

CTBS purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00001486-D01P
CTBS purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human CTBS protein.
Información adicional
Size 100 ug
Gene Name CTBS
Gene Alias CTB
Gene Description chitobiase, di-N-acetyl-
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MSRPQLRRWRLVSSPPSGVPGLALLALLALLALRLAAGTDCPCPEPELCRPIRHHPDFEVFVFDVGQKTWKSYDWSQITTVATFGKYDSELMCYAHSKGARVVLKGDVSLKDIIDPAFRASWIAQKLNLAKTQYMDGINIDIEQEVNCLSPEYDALTALVKETTDSFHREIEGSQVTFDVAWSPKNIDRRCYNYTGIADACDFLFVMSYDEQSQIWSECIAAANAPYNQTLTGYNDYIKMSINPKKLVMGVPWYG
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CTBS (NP_004379.1, 1 a.a. ~ 385 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1486

Enviar uma mensagem


CTBS purified MaxPab rabbit polyclonal antibody (D01P)

CTBS purified MaxPab rabbit polyclonal antibody (D01P)