NKX2-5 monoclonal antibody (M04), clone 3C1
  • NKX2-5 monoclonal antibody (M04), clone 3C1

NKX2-5 monoclonal antibody (M04), clone 3C1

Ref: AB-H00001482-M04
NKX2-5 monoclonal antibody (M04), clone 3C1

Información del producto

Mouse monoclonal antibody raised against a full length recombinant NKX2-5.
Información adicional
Size 100 ug
Gene Name NKX2-5
Gene Alias CHNG5|CSX|CSX1|NKX2.5|NKX2E|NKX4-1
Gene Description NK2 transcription factor related, locus 5 (Drosophila)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IP,ELISA,IF
Immunogen Prot. Seq MFPSPALTPTPFSVKDILNLEQQQRSLAAAGELSARLEATLAPSSCMLAAFKPEAYAGPEAAAPGLPELRAELGRAPSPAKCASAFPAAPAFYPRAYSDPDPAKDPRAEKKELCALQKAVELEKTEADNA*
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen NKX2-5 (NP_004378, 1 a.a. ~ 130 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1482
Clone Number 3C1
Iso type IgG2a Kappa

Enviar uma mensagem


NKX2-5 monoclonal antibody (M04), clone 3C1

NKX2-5 monoclonal antibody (M04), clone 3C1